Lineage for d1imcb_ (1imc B:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2621435Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. 2621436Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) (S)
  5. 2621437Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (7 proteins)
  6. 2621653Protein Inositol monophosphatase [56663] (1 species)
  7. 2621654Species Human (Homo sapiens) [TaxId:9606] [56664] (11 PDB entries)
  8. 2621675Domain d1imcb_: 1imc B: [42967]
    complexed with cl, mn

Details for d1imcb_

PDB Entry: 1imc (more details), 2.6 Å

PDB Description: structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis
PDB Compounds: (B:) inositol monophosphatase

SCOPe Domain Sequences for d1imcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1imcb_ e.7.1.1 (B:) Inositol monophosphatase {Human (Homo sapiens) [TaxId: 9606]}
wqecmdyavtlarqagevvceaiknemnvmlksspvdlvtatdqkvekmlissikekyps
hsfigeesvaageksiltdnptwiidpidgttnfvhrfpfvavsigfavnkkiefgvvys
cvegkmytarkgkgafcngqklqvsqqeditksllvtelgssrtpetvrmvlsnmeklfc
ipvhgirsvgtaavnmclvatggadayyemgihcwdvagagiivteaggvlmdvtggpfd
lmsrrviaannrilaeriakeiqviplqrdded

SCOPe Domain Coordinates for d1imcb_:

Click to download the PDB-style file with coordinates for d1imcb_.
(The format of our PDB-style files is described here.)

Timeline for d1imcb_: