Lineage for d1imcb_ (1imc B:)

  1. Root: SCOP 1.55
  2. 37754Class e: Multi-domain proteins (alpha and beta) [56572] (28 folds)
  3. 38091Fold e.7: Sugar phosphatases [56654] (1 superfamily)
  4. 38092Superfamily e.7.1: Sugar phosphatases [56655] (1 family) (S)
  5. 38093Family e.7.1.1: Sugar phosphatases [56656] (5 proteins)
  6. 38189Protein Inositol monophosphatase [56663] (1 species)
  7. 38190Species Human (Homo sapiens) [TaxId:9606] [56664] (8 PDB entries)
  8. 38203Domain d1imcb_: 1imc B: [42967]

Details for d1imcb_

PDB Entry: 1imc (more details), 2.6 Å

PDB Description: structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis

SCOP Domain Sequences for d1imcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1imcb_ e.7.1.1 (B:) Inositol monophosphatase {Human (Homo sapiens)}
wqecmdyavtlarqagevvceaiknemnvmlksspvdlvtatdqkvekmlissikekyps
hsfigeesvaageksiltdnptwiidpidgttnfvhrfpfvavsigfavnkkiefgvvys
cvegkmytarkgkgafcngqklqvsqqeditksllvtelgssrtpetvrmvlsnmeklfc
ipvhgirsvgtaavnmclvatggadayyemgihcwdvagagiivteaggvlmdvtggpfd
lmsrrviaannrilaeriakeiqviplqrdded

SCOP Domain Coordinates for d1imcb_:

Click to download the PDB-style file with coordinates for d1imcb_.
(The format of our PDB-style files is described here.)

Timeline for d1imcb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1imca_