Lineage for d1ivhd2 (1ivh D:6-241)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2246106Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 2246107Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 2246108Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (10 proteins)
  6. 2246143Protein Isovaleryl-coa dehydrogenase, NM domains [56652] (1 species)
  7. 2246144Species Human (Homo sapiens) [TaxId:9606] [56653] (1 PDB entry)
  8. 2246148Domain d1ivhd2: 1ivh D:6-241 [42872]
    Other proteins in same PDB: d1ivha1, d1ivhb1, d1ivhc1, d1ivhd1
    complexed with cos, fad

Details for d1ivhd2

PDB Entry: 1ivh (more details), 2.6 Å

PDB Description: structure of human isovaleryl-coa dehydrogenase at 2.6 angstroms resolution: structural basis for substrate specificity
PDB Compounds: (D:) isovaleryl-coa dehydrogenase

SCOPe Domain Sequences for d1ivhd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ivhd2 e.6.1.1 (D:6-241) Isovaleryl-coa dehydrogenase, NM domains {Human (Homo sapiens) [TaxId: 9606]}
vddainglseeqrqlrqtmakflqehlapkaqeidrsnefknlrefwkqlgnlgvlgita
pvqyggsglgylehvlvmeeisrasgavglsygahsnlcinqlvrngneaqkekylpkli
sgeyigalamsepnagsdvvsmklkaekkgnhyilngnkfwitngpdadvlivyaktdla
avpasrgitafivekgmpgfstskkldklgmrgsntcelifedckipaanilghen

SCOPe Domain Coordinates for d1ivhd2:

Click to download the PDB-style file with coordinates for d1ivhd2.
(The format of our PDB-style files is described here.)

Timeline for d1ivhd2: