SCOPe 2.06: Domain d1ivhd1: 1ivh D:242-392

Lineage for d1ivhd1 (1ivh D:242-392)

Root: SCOPe 2.06
Class a: All alpha proteins [46456] (289 folds)
Fold a.29: Bromodomain-like [47363] (15 superfamilies)
4 helices; bundle; minor mirror variant of up-and-down topology
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families)
multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (10 proteins)
Protein Isovaleryl-CoA dehydrogenase, C-domain [47210] (1 species)
Species Human (Homo sapiens) [TaxId:9606] [47211] (1 PDB entry)
Domain d1ivhd1: 1ivh D:242-392 [16611]
Other proteins in same PDB: d1ivha2, d1ivhb2, d1ivhc2, d1ivhd2
complexed with cos, fad

Details for d1ivhd1

PDB Entry: 1ivh (more details), 2.6 Å

PDB Description: structure of human isovaleryl-coa dehydrogenase at 2.6 angstroms resolution: structural basis for substrate specificity

PDB Compounds: (D:) isovaleryl-coa dehydrogenase

SCOPe Domain Sequences for d1ivhd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ivhd1 a.29.3.1 (D:242-392) Isovaleryl-CoA dehydrogenase, C-domain {Human (Homo sapiens) [TaxId: 9606]}
kgvyvlmsgldlerlvlaggplglmqavldhtipylhvreafgqkighfqlmqgkmadmy
trlmacrqyvynvakacdeghctakdcagvilysaecatqvaldgiqcfggngyindfpm
grflrdaklyeigagtsevrrlvigrafnad

SCOPe Domain Coordinates for d1ivhd1:

Click to download the PDB-style file with coordinates for d1ivhd1.
(The format of our PDB-style files is described here.)

Timeline for d1ivhd1: