SCOP 1.61: Domain d1erqa_: 1erq A:

Lineage for d1erqa_ (1erq A:)

1. Root: SCOP 1.61

2. Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)

3. Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily)

4. Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (8 proteins)

6. Protein beta-Lactamase, class A [56606] (13 species)

7. Species Escherichia coli, TEM-1 [TaxId:562] [56607] (18 PDB entries)

8. Domain d1erqa_: 1erq A: [42697]

Details for d1erqa_

PDB Entry: 1erq, 1.9 Å

PDB Description: x-ray crystal structure of tem-1 beta lactamase in complex with a designed boronic acid inhibitor (1r)-1-acetamido-2-(3-carboxy-2-hydroxyphenyl)ethyl boronic acid

SCOP Domain Sequences for d1erqa_:

Sequence; same for both SEQRES and ATOM records:

>d1erqa_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TEM-1}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdttmpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw

Timeline for d1erqa_:

• d1erqa_ first appeared (with stable ids) in SCOP 1.55
  
• d1erqa_ appears in SCOP 1.59
  
• d1erqa_ appears in SCOP 1.63
  
• d1erqa_ appears in the current release, SCOPe 2.08