SCOP 1.63: Domain d1xpb__: 1xpb -

Lineage for d1xpb__ (1xpb -)

1. Root: SCOP 1.63

2. Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)

3. Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (9 proteins)

6. Protein beta-Lactamase, class A [56606] (13 species)

7. Species Escherichia coli, TEM-1 [TaxId:562] [56607] (21 PDB entries)

8. Domain d1xpb__: 1xpb - [42694]
   complexed with so4

Details for d1xpb__

PDB Entry: 1xpb, 1.9 Å

PDB Description: structure of beta-lactamase tem1

SCOP Domain Sequences for d1xpb__:

Sequence; same for both SEQRES and ATOM records:

>d1xpb__ e.3.1.1 (-) beta-Lactamase, class A {Escherichia coli, TEM-1}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdttmpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw

Timeline for d1xpb__:

• d1xpb__ first appeared (with stable ids) in SCOP 1.55
  
• d1xpb__ appears in SCOP 1.61
  
• d1xpb__ appears in SCOP 1.65
  
• d1xpb__ appears in the current release, SCOPe 2.08, called d1xpba_