Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily) unusual fold; contains a left-handed beta-alpha-beta unit |
Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) automatically mapped to Pfam PF01000 |
Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins) |
Protein RNA polymerase alpha subunit [56555] (3 species) |
Species Escherichia coli [TaxId:562] [56556] (1 PDB entry) |
Domain d1bdfc2: 1bdf C:53-178 [42604] Other proteins in same PDB: d1bdfa1, d1bdfb1, d1bdfc1, d1bdfd1 |
PDB Entry: 1bdf (more details), 2.5 Å
SCOPe Domain Sequences for d1bdfc2:
Sequence, based on SEQRES records: (download)
>d1bdfc2 d.181.1.1 (C:53-178) RNA polymerase alpha subunit {Escherichia coli [TaxId: 562]} gcavteveidgvlheystkegvqedileillnlkglavrvqgkdeviltlnksgigpvta adithdgdveivkpqhvichltdenasismrikvqrgrgyvpastrihseederpigrll vdacys
>d1bdfc2 d.181.1.1 (C:53-178) RNA polymerase alpha subunit {Escherichia coli [TaxId: 562]} gcavteveidgvlheystkegvqedileillnlkglavrvqgkdeviltlnksgigpvta adithdgdveivkpqhvichltdenasismrikvqrgrgyvpastrihigrllvdacys
Timeline for d1bdfc2: