Lineage for d1bdfc2 (1bdf C:53-178)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 37718Fold d.181: Insert subdomain of RNA polymerase alpha subunit N-terminal domain [56552] (1 superfamily)
  4. 37719Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit N-terminal domain [56553] (1 family) (S)
  5. 37720Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit N-terminal domain [56554] (1 protein)
  6. 37721Protein Insert subdomain of RNA polymerase alpha subunit N-terminal domain [56555] (1 species)
  7. 37722Species Escherichia coli [TaxId:562] [56556] (1 PDB entry)
  8. 37725Domain d1bdfc2: 1bdf C:53-178 [42604]
    Other proteins in same PDB: d1bdfa1, d1bdfb1, d1bdfc1, d1bdfd1

Details for d1bdfc2

PDB Entry: 1bdf (more details), 2.5 Å

PDB Description: structure of escherichia coli rna polymerase alpha subunit n-terminal domain

SCOP Domain Sequences for d1bdfc2:

Sequence, based on SEQRES records: (download)

>d1bdfc2 d.181.1.1 (C:53-178) Insert subdomain of RNA polymerase alpha subunit N-terminal domain {Escherichia coli}
gcavteveidgvlheystkegvqedileillnlkglavrvqgkdeviltlnksgigpvta
adithdgdveivkpqhvichltdenasismrikvqrgrgyvpastrihseederpigrll
vdacys

Sequence, based on observed residues (ATOM records): (download)

>d1bdfc2 d.181.1.1 (C:53-178) Insert subdomain of RNA polymerase alpha subunit N-terminal domain {Escherichia coli}
gcavteveidgvlheystkegvqedileillnlkglavrvqgkdeviltlnksgigpvta
adithdgdveivkpqhvichltdenasismrikvqrgrgyvpastrihigrllvdacys

SCOP Domain Coordinates for d1bdfc2:

Click to download the PDB-style file with coordinates for d1bdfc2.
(The format of our PDB-style files is described here.)

Timeline for d1bdfc2: