SCOP 1.61: Domain d1dq9a4: 1dq9 A:461-586,A:704-865

Lineage for d1dq9a4 (1dq9 A:461-586,A:704-865)

Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
Fold d.179: Substrate-binding domain of HMG-CoA reductase [56541] (1 superfamily)
Superfamily d.179.1: Substrate-binding domain of HMG-CoA reductase [56542] (1 family)
Family d.179.1.1: Substrate-binding domain of HMG-CoA reductase [56543] (1 protein)
Protein Substrate-binding domain of HMG-CoA reductase [56544] (2 species)
Species Human (Homo sapiens) [TaxId:9606] [56545] (9 PDB entries)
Domain d1dq9a4: 1dq9 A:461-586,A:704-865 [42593]
Other proteins in same PDB: d1dq9a1, d1dq9b1, d1dq9c1, d1dq9d1

Details for d1dq9a4

PDB Entry: 1dq9 (more details), 2.8 Å

PDB Description: complex of catalytic portion of human hmg-coa reductase with hmg-coa

SCOP Domain Sequences for d1dq9a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dq9a4 d.179.1.1 (A:461-586,A:704-865) Substrate-binding domain of HMG-CoA reductase {Human (Homo sapiens)}
flsdaeiiqlvnakhipaykletliethergvsirrqllskklsepsslqylpyrdynys
lvmgaccenvigympipvgvagplcldekefqvpmattegclvastnrgcraiglgggas
srvladXksvvceavipakvvrevlkttteamievninknlvgsamagsiggynahaani
vtaiyiacgqdaaqnvgssncitlmeasgptnedlyisctmpsieigtvgggtnllpqqa
clqmlgvqgackdnpgenarqlarivcgtvmagelslmaalaaghlvks

SCOP Domain Coordinates for d1dq9a4:

Click to download the PDB-style file with coordinates for d1dq9a4.
(The format of our PDB-style files is described here.)

Timeline for d1dq9a4: