SCOP 1.59: Domain d2nseb_: 2nse B:

Lineage for d2nseb_ (2nse B:)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)

4. Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family)

5. Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (1 protein)

6. Protein Nitric oxide (NO) synthase oxygenase domain [56514] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [56517] (27 PDB entries)

8. Domain d2nseb_: 2nse B: [42559]

Details for d2nseb_

PDB Entry: 2nse, 2.34 Å

PDB Description: bovine endothelial nitric oxide synthase substrate complex

SCOP Domain Sequences for d2nseb_:

Sequence; same for both SEQRES and ATOM records:

>d2nseb_ d.174.1.1 (B:) Nitric oxide (NO) synthase oxygenase domain {Cow (Bos taurus)}
kfprvknwelgsitydtlcaqsqqdgpctprrclgslvlprklqtrpspgpppaeqllsq
ardfinqyyssikrsgsqaheerlqeveaevastgtyhlreselvfgakqawrnaprcvg
riqwgklqvfdardcssaqemftyicnhikyatnrgnlrsaitvfpqrapgrgdfriwns
qlvryagyrqqdgsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeapelfvlp
pelvlevplehptlewfaalglrwyalpavsnmlleigglefsaapfsgwymsteigtrn
lcdphryniledvavcmdldtrttsslwkdkaaveinlavlhsfqlakvtivdhhaatvs
fmkhldneqkarggcpadwawivppisgsltpvfhqemvnyilspafryqpdpw

Timeline for d2nseb_:

• d2nseb_ first appeared (with stable ids) in SCOP 1.55
  
• d2nseb_ appears in SCOP 1.57
  
• d2nseb_ appears in SCOP 1.61
  
• d2nseb_ appears in the current release, SCOPe 2.08