Lineage for d2nsea_ (2nse A:)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily) Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) 
Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (1 protein) Protein Nitric oxide (NO) synthase oxygenase domain [56514] (3 species) Species Cow (Bos taurus) [TaxId:9913] [56517] (27 PDB entries) 
Domain d2nsea_: 2nse A: [42558]
Details for d2nsea_
PDB Entry: 2nse (more details), 2.34 Å
PDB Description: bovine endothelial nitric oxide synthase substrate complex
SCOP Domain Sequences for d2nsea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nsea_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Cow (Bos taurus)}
gpkfprvknwelgsitydtlcaqsqqdgpctprrclgslvlprklqtrpspgpppaeqll
sqardfinqyyssikrsgsqaheerlqeveaevastgtyhlreselvfgakqawrnaprc
vgriqwgklqvfdardcssaqemftyicnhikyatnrgnlrsaitvfpqrapgrgdfriw
nsqlvryagyrqqdgsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeapelfv
lppelvlevplehptlewfaalglrwyalpavsnmlleigglefsaapfsgwymsteigt
rnlcdphryniledvavcmdldtrttsslwkdkaaveinlavlhsfqlakvtivdhhaat
vsfmkhldneqkarggcpadwawivppisgsltpvfhqemvnyilspafryqpdpw
SCOP Domain Coordinates for d2nsea_:
Click to download the PDB-style file with coordinates for d2nsea_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2nsea_:
- d2nsea_ first appeared (with stable ids) in SCOP 1.55
- d2nsea_ appears in SCOP 1.57
- d2nsea_ appears in SCOP 1.61
- d2nsea_ appears in the current release, SCOPe 2.08
View in 3D
