Lineage for d1fzgc1 (1fzg C:142-393)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 264784Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
    unusual fold
  4. 264785Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (1 family) (S)
  5. 264786Family d.171.1.1: Fibrinogen C-terminal domain-like [56497] (2 proteins)
  6. 264787Protein Fibrinogen C-terminal domains [56498] (7 species)
  7. 264824Species Human (Homo sapiens), gamma [TaxId:9606] [68904] (15 PDB entries)
  8. 264837Domain d1fzgc1: 1fzg C:142-393 [42469]
    Other proteins in same PDB: d1fzga_, d1fzgb2, d1fzgc2, d1fzgd_, d1fzge2, d1fzgf2

Details for d1fzgc1

PDB Entry: 1fzg (more details), 2.5 Å

PDB Description: crystal structure of fragment d from human fibrinogen with the peptide ligand gly-his-arg-pro-amide

SCOP Domain Sequences for d1fzgc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzgc1 d.171.1.1 (C:142-393) Fibrinogen C-terminal domains {Human (Homo sapiens), gamma}
tvqihditgkdcqdiankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgs
vdfkknwiqykegfghlsptgttefwlgnekihlistqsaipyalrveledwngrtstad
yamfkvgpeadkyrltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndk
fegncaeqdgsgwwmnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkk
ttmkiipfnrlt

SCOP Domain Coordinates for d1fzgc1:

Click to download the PDB-style file with coordinates for d1fzgc1.
(The format of our PDB-style files is described here.)

Timeline for d1fzgc1: