SCOPe 2.04: Domain d1byfb_: 1byf B:

Lineage for d1byfb_ (1byf B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein Lectin TC14 [56463] (1 species)

7. Species Tunicate (Polyandrocarpa misakiensis) [TaxId:7723] [56464] (2 PDB entries)

8. Domain d1byfb_: 1byf B: [42420]
   CASP3
   complexed with act, ca, gol, zn

Details for d1byfb_

PDB Entry: 1byf, 2 Å

PDB Description: structure of tc14; a c-type lectin from the tunicate polyandrocarpa misakiensis

PDB Compounds: (B:) protein (polyandrocarpa lectin)

SCOPe Domain Sequences for d1byfb_:

Sequence; same for both SEQRES and ATOM records:

>d1byfb_ d.169.1.1 (B:) Lectin TC14 {Tunicate (Polyandrocarpa misakiensis) [TaxId: 7723]}
dyeilfsdetmnyadagtycqsrgmalvssamrdstmvkailaftevkghdywvgadnlq
dgaynflwndgvslptdsdlwspnepsnpqswqlcvqiwskynllddvgcggarrvicek
eld

Timeline for d1byfb_:

• d1byfb_ first appeared (with stable ids) in SCOP 1.55
  
• d1byfb_ appears in SCOPe 2.03
  
• d1byfb_ appears in SCOPe 2.05
  
• d1byfb_ appears in the current release, SCOPe 2.08