Lineage for d1byfb_ (1byf B:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 139425Fold d.169: C-type lectin-like [56435] (1 superfamily)
  4. 139426Superfamily d.169.1: C-type lectin-like [56436] (5 families) (S)
  5. 139427Family d.169.1.1: C-type lectin domain [56437] (17 proteins)
  6. 139474Protein Lectin TC14 [56463] (1 species)
  7. 139475Species Tunicate (Polyandrocarpa misakiensis) [TaxId:7723] [56464] (2 PDB entries)
  8. 139477Domain d1byfb_: 1byf B: [42420]

Details for d1byfb_

PDB Entry: 1byf (more details), 2 Å

PDB Description: structure of tc14; a c-type lectin from the tunicate polyandrocarpa misakiensis

SCOP Domain Sequences for d1byfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1byfb_ d.169.1.1 (B:) Lectin TC14 {Tunicate (Polyandrocarpa misakiensis)}
dyeilfsdetmnyadagtycqsrgmalvssamrdstmvkailaftevkghdywvgadnlq
dgaynflwndgvslptdsdlwspnepsnpqswqlcvqiwskynllddvgcggarrvicek
eld

SCOP Domain Coordinates for d1byfb_:

Click to download the PDB-style file with coordinates for d1byfb_.
(The format of our PDB-style files is described here.)

Timeline for d1byfb_: