| Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
| Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (6 families) ![]() |
| Family d.169.1.1: C-type lectin domain [56437] (18 proteins) |
| Protein Mannose-binding protein A, lectin domain [56458] (2 species) |
| Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries) |
| Domain d1bcj31: 1bcj 3:105-226 [42413] Other proteins in same PDB: d1bcj12, d1bcj22, d1bcj32 complexed with ca, cl, nga; mutant |
PDB Entry: 1bcj (more details), 2.1 Å
SCOP Domain Sequences for d1bcj31:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bcj31 d.169.1.1 (3:105-226) Mannose-binding protein A, lectin domain {Rat (Rattus norvegicus)}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktvaflgitdevt
egqfmyvtggrltysnwkkdqpddwyghglgggedcvhivdnglwndiscqashtavcef
pa
Timeline for d1bcj31:
View in 3DDomains from other chains: (mouse over for more information) d1bcj11, d1bcj12, d1bcj21, d1bcj22 |