Lineage for d1bcj31 (1bcj 3:105-226)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 264459Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 264460Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 264461Family d.169.1.1: C-type lectin domain [56437] (18 proteins)
  6. 264527Protein Mannose-binding protein A, lectin domain [56458] (2 species)
  7. 264530Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)
  8. 264620Domain d1bcj31: 1bcj 3:105-226 [42413]
    Other proteins in same PDB: d1bcj12, d1bcj22, d1bcj32
    complexed with ca, cl, nga; mutant

Details for d1bcj31

PDB Entry: 1bcj (more details), 2.1 Å

PDB Description: mannose-binding protein-a mutant (qpdwghv) complexed with n-acetyl-d- galactosamine

SCOP Domain Sequences for d1bcj31:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bcj31 d.169.1.1 (3:105-226) Mannose-binding protein A, lectin domain {Rat (Rattus norvegicus)}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktvaflgitdevt
egqfmyvtggrltysnwkkdqpddwyghglgggedcvhivdnglwndiscqashtavcef
pa

SCOP Domain Coordinates for d1bcj31:

Click to download the PDB-style file with coordinates for d1bcj31.
(The format of our PDB-style files is described here.)

Timeline for d1bcj31: