| Class d: Alpha and beta proteins (a+b) [53931] (224 folds) | 
| Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold  | 
Superfamily d.169.1: C-type lectin-like [56436] (6 families) ![]()  | 
| Family d.169.1.1: C-type lectin domain [56437] (18 proteins) | 
| Protein Mannose-binding protein A, lectin domain [56458] (2 species) | 
| Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries) | 
| Domain d1kmb21: 1kmb 2:105-221 [42406] Other proteins in same PDB: d1kmb12, d1kmb22, d1kmb32  | 
PDB Entry: 1kmb (more details), 2.1 Å
SCOP Domain Sequences for d1kmb21:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kmb21 d.169.1.1 (2:105-221) Mannose-binding protein A, lectin domain {Rat (Rattus norvegicus)}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqkkktavcefpa
Timeline for d1kmb21:
 View in 3DDomains from other chains: (mouse over for more information) d1kmb11, d1kmb12, d1kmb31, d1kmb32  |