Lineage for d3kmb21 (3kmb 2:105-221)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 264459Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 264460Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 264461Family d.169.1.1: C-type lectin domain [56437] (18 proteins)
  6. 264527Protein Mannose-binding protein A, lectin domain [56458] (2 species)
  7. 264530Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)
  8. 264598Domain d3kmb21: 3kmb 2:105-221 [42391]
    Other proteins in same PDB: d3kmb12, d3kmb22, d3kmb32

Details for d3kmb21

PDB Entry: 3kmb (more details), 1.95 Å

PDB Description: complex of 3'-sulfo-lewis-x with a selectin-like mutant of mannose- binding protein a

SCOP Domain Sequences for d3kmb21:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kmb21 d.169.1.1 (2:105-221) Mannose-binding protein A, lectin domain {Rat (Rattus norvegicus)}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqkkktavcefpa

SCOP Domain Coordinates for d3kmb21:

Click to download the PDB-style file with coordinates for d3kmb21.
(The format of our PDB-style files is described here.)

Timeline for d3kmb21: