Lineage for d2kmb21 (2kmb 2:105-221)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1048063Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1048064Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1048065Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1048173Protein Mannose-binding protein A, C-lectin domain [56458] (2 species)
  7. 1048176Species Norway rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)
  8. 1048213Domain d2kmb21: 2kmb 2:105-221 [42388]
    Other proteins in same PDB: d2kmb12, d2kmb22, d2kmb32
    complexed with ca, cl; mutant

Details for d2kmb21

PDB Entry: 2kmb (more details), 2 Å

PDB Description: complex of 3'-neuac-lewis-x with a selectin-like mutant of mannose- binding protein a
PDB Compounds: (2:) mannose-binding protein-a

SCOPe Domain Sequences for d2kmb21:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kmb21 d.169.1.1 (2:105-221) Mannose-binding protein A, C-lectin domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqkkktavcefpa

SCOPe Domain Coordinates for d2kmb21:

Click to download the PDB-style file with coordinates for d2kmb21.
(The format of our PDB-style files is described here.)

Timeline for d2kmb21: