Lineage for d1bv4c_ (1bv4 C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2234637Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2234638Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2234639Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 2234795Protein Mannose-binding protein A, C-lectin domain [56458] (2 species)
  7. 2234798Species Norway rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)
  8. 2234841Domain d1bv4c_: 1bv4 C: [42382]

Details for d1bv4c_

PDB Entry: 1bv4 (more details), 1.85 Å

PDB Description: apo-mannose-binding protein-c
PDB Compounds: (C:) protein (mannose-binding protein-c)

SCOPe Domain Sequences for d1bv4c_:

Sequence, based on SEQRES records: (download)

>d1bv4c_ d.169.1.1 (C:) Mannose-binding protein A, C-lectin domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kyfmssvrrmplnrakalcselqgtvatprnaeenraiqnvakdvaflgitdqrtenvfe
dltgnrvrytnwnegepnnvgsgencvvlltngkwndvpcsdsflvvcefs

Sequence, based on observed residues (ATOM records): (download)

>d1bv4c_ d.169.1.1 (C:) Mannose-binding protein A, C-lectin domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kyfmssvrrmplnrakalcselqgtvatprnaeenraiqnvakdvaflgiedltgcvvll
tngkwndvpcsdsflvvcefs

SCOPe Domain Coordinates for d1bv4c_:

Click to download the PDB-style file with coordinates for d1bv4c_.
(The format of our PDB-style files is described here.)

Timeline for d1bv4c_: