SCOPe 2.02: Domain d1fifc1: 1fif C:105-226

Lineage for d1fifc1 (1fif C:105-226)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein Mannose-binding protein A, C-lectin domain [56458] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)

8. Domain d1fifc1: 1fif C:105-226 [42375]
   Other proteins in same PDB: d1fifa2, d1fifb2, d1fifc2
   complexed with ca, cl; mutant

Details for d1fifc1

PDB Entry: 1fif, 1.95 Å

PDB Description: n-acetylgalactosamine-selective mutant of mannose-binding protein-a (qpdwg-hdrpy)

PDB Compounds: (C:) mannose-binding protein-a

SCOPe Domain Sequences for d1fifc1:

Sequence; same for both SEQRES and ATOM records:

>d1fifc1 d.169.1.1 (C:105-226) Mannose-binding protein A, C-lectin domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdqpddwyghglgggedcvhivdnglwnddscqrpytavcef
pa

Timeline for d1fifc1:

• d1fifc1 first appeared (with stable ids) in SCOP 1.55
  
• d1fifc1 appears in SCOPe 2.01
  
• d1fifc1 appears in SCOPe 2.03
  
• d1fifc1 appears in the current release, SCOPe 2.08