![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
![]() | Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
![]() | Protein Mannose-binding protein A, C-lectin domain [56458] (2 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries) |
![]() | Domain d1fifb1: 1fif B:105-226 [42374] Other proteins in same PDB: d1fifa2, d1fifb2, d1fifc2 complexed with ca, cl; mutant |
PDB Entry: 1fif (more details), 1.95 Å
SCOPe Domain Sequences for d1fifb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fifb1 d.169.1.1 (B:105-226) Mannose-binding protein A, C-lectin domain {Norway rat (Rattus norvegicus) [TaxId: 10116]} kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt egqfmyvtggrltysnwkkdqpddwyghglgggedcvhivdnglwnddscqrpytavcef pa
Timeline for d1fifb1:
![]() Domains from other chains: (mouse over for more information) d1fifa1, d1fifa2, d1fifc1, d1fifc2 |