Lineage for d1rdj2_ (1rdj 2:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1682071Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1682072Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1682073Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1682229Protein Mannose-binding protein A, C-lectin domain [56458] (2 species)
  7. 1682232Species Norway rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)
  8. 1682244Domain d1rdj2_: 1rdj 2: [42370]
    complexed with ca, cl, mfb

Details for d1rdj2_

PDB Entry: 1rdj (more details), 1.8 Å

PDB Description: mannose-binding protein, subtilisin digest fragment complex with beta- methyl-l-fucopyranoside
PDB Compounds: (2:) mannose-binding protein-c

SCOPe Domain Sequences for d1rdj2_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rdj2_ d.169.1.1 (2:) Mannose-binding protein A, C-lectin domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kkyfmssvrrmplnrakalcselqgtvatprnaeenraiqnvakdvaflgitdqrtenvf
edltgnrvrytnwnegepnnvgsgencvvlltngkwndvpcsdsflvvcefs

SCOPe Domain Coordinates for d1rdj2_:

Click to download the PDB-style file with coordinates for d1rdj2_.
(The format of our PDB-style files is described here.)

Timeline for d1rdj2_: