|  | Class d: Alpha and beta proteins (a+b) [53931] (234 folds) | 
|  | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold | 
|  | Superfamily d.169.1: C-type lectin-like [56436] (6 families)  | 
|  | Family d.169.1.1: C-type lectin domain [56437] (21 proteins) | 
|  | Protein Mannose-binding protein A, lectin domain [56458] (2 species) | 
|  | Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries) | 
|  | Domain d1rtm31: 1rtm 3:105-221 [42365] Other proteins in same PDB: d1rtm12, d1rtm22, d1rtm32 complexed with ca, cl, gol | 
PDB Entry: 1rtm (more details), 1.8 Å
SCOP Domain Sequences for d1rtm31:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rtm31 d.169.1.1 (3:105-221) Mannose-binding protein A, lectin domain {Rat (Rattus norvegicus)}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqashtavcefpa
Timeline for d1rtm31:
|  View in 3D Domains from other chains: (mouse over for more information) d1rtm11, d1rtm12, d1rtm21, d1rtm22 |