| Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
| Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (6 families) ![]() |
| Family d.169.1.1: C-type lectin domain [56437] (21 proteins) |
| Protein Mannose-binding protein A, lectin domain [56458] (2 species) |
| Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries) |
| Domain d1rtm11: 1rtm 1:105-221 [42363] Other proteins in same PDB: d1rtm12, d1rtm22, d1rtm32 |
PDB Entry: 1rtm (more details), 1.8 Å
SCOP Domain Sequences for d1rtm11:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rtm11 d.169.1.1 (1:105-221) Mannose-binding protein A, lectin domain {Rat (Rattus norvegicus)}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqashtavcefpa
Timeline for d1rtm11:
View in 3DDomains from other chains: (mouse over for more information) d1rtm21, d1rtm22, d1rtm31, d1rtm32 |