SCOPe 2.08: Domain d1rtm11: 1rtm 1:105-221

Lineage for d1rtm11 (1rtm 1:105-221)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein Mannose-binding protein A, C-lectin domain [56458] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)

8. Domain d1rtm11: 1rtm 1:105-221 [42363]
   Other proteins in same PDB: d1rtm12, d1rtm22, d1rtm32
   complexed with ca, cl, gol

Details for d1rtm11

PDB Entry: 1rtm, 1.8 Å

PDB Description: trimeric structure of a c-type mannose-binding protein

PDB Compounds: (1:) mannose-binding protein-a

SCOPe Domain Sequences for d1rtm11:

Sequence; same for both SEQRES and ATOM records:

>d1rtm11 d.169.1.1 (1:105-221) Mannose-binding protein A, C-lectin domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqashtavcefpa

Timeline for d1rtm11:

• d1rtm11 first appeared (with stable ids) in SCOP 1.55
  
• d1rtm11 appears in SCOPe 2.07