Lineage for d7xqmb_ (7xqm B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842913Protein automated matches [190085] (59 species)
    not a true protein
  7. 3087312Species Thermus thermophilus [TaxId:262724] [423629] (1 PDB entry)
  8. 3087321Domain d7xqmb_: 7xqm B: [423638]
    automated match to d2d1yb_
    complexed with sah; mutant

Details for d7xqmb_

PDB Entry: 7xqm (more details), 2.71 Å

PDB Description: indel-mutant short chain dehydrogenase bound to sah
PDB Compounds: (B:) dehydrogenase

SCOPe Domain Sequences for d7xqmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7xqmb_ c.2.1.2 (B:) automated matches {Thermus thermophilus [TaxId: 262724]}
mglfagkgvlvtgggigaiaqafaregalvalcdlrpegkevaeaiggaffqvdledere
rvrfveeaayalgrvdvlvnnaaiaapgsaltvrlpewrrvlevnltapmhlsalaarem
rkvgggaivnvasvqglfaeqenaaynaskgglvnltrslaldlaplrirvnavapgaia
teavleaialspdpertrrdwedlhalrrlgkpeevaeavlflasekasfitgailpvdg
gmtasfmmagrpv

SCOPe Domain Coordinates for d7xqmb_:

Click to download the PDB-style file with coordinates for d7xqmb_.
(The format of our PDB-style files is described here.)

Timeline for d7xqmb_:

  • d7xqmb_ is new in SCOPe 2.08-stable