Lineage for d7vvrt_ (7vvr T:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3024907Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family) (S)
    automatically mapped to Pfam PF02046
  5. 3024908Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (2 proteins)
  6. 3024909Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species)
    probably responsible for the dimerization of the mitochondrial cytochrome c oxidase
  7. 3024910Species Cow (Bos taurus) [TaxId:9913] [81408] (56 PDB entries)
  8. 3087244Domain d7vvrt_: 7vvr T: [423561]
    Other proteins in same PDB: d7vvra_, d7vvrb1, d7vvrb2, d7vvrc_, d7vvrd_, d7vvre_, d7vvrf_, d7vvrh_, d7vvri_, d7vvrj_, d7vvrk_, d7vvrl_, d7vvrm_, d7vvrn_, d7vvro1, d7vvro2, d7vvrp_, d7vvrq_, d7vvrr_, d7vvrs_, d7vvru_, d7vvrv_, d7vvrw_, d7vvrx_, d7vvry_, d7vvrz_
    automated match to d1occg_
    complexed with cdl, chd, cu, cua, cyn, dmu, edo, hea, mg, na, pek, pgv, po4, psc, tgl, zn

Details for d7vvrt_

PDB Entry: 7vvr (more details), 1.65 Å

PDB Description: bovine cytochrome c oxidese in cn-bound mixed valence state at 50 k
PDB Compounds: (T:) Cytochrome c oxidase subunit 6A2, mitochondrial

SCOPe Domain Sequences for d7vvrt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7vvrt_ f.23.2.1 (T:) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]}
asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
swgdgnhtffhnprvnplptgyek

SCOPe Domain Coordinates for d7vvrt_:

Click to download the PDB-style file with coordinates for d7vvrt_.
(The format of our PDB-style files is described here.)

Timeline for d7vvrt_:

  • d7vvrt_ is new in SCOPe 2.08-stable