Lineage for d1c3ab_ (1c3a B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1226319Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1226320Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1226321Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1226631Protein Snake coagglutinin beta chain [88867] (10 species)
    heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)
  7. 1226642Species Habu snake (Trimeresurus flavoviridis), flavocetin-A [TaxId:88087] [88869] (1 PDB entry)
  8. 1226643Domain d1c3ab_: 1c3a B: [42344]
    Other proteins in same PDB: d1c3aa_

Details for d1c3ab_

PDB Entry: 1c3a (more details), 2.5 Å

PDB Description: crystal structure of flavocetin-a from the habu snake venom, a novel cyclic tetramer of c-type lectin-like heterodimers
PDB Compounds: (B:) flavocetin-a: beta subunit

SCOPe Domain Sequences for d1c3ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c3ab_ d.169.1.1 (B:) Snake coagglutinin beta chain {Habu snake (Trimeresurus flavoviridis), flavocetin-A [TaxId: 88087]}
gfccplgwssydehcyqvfqqkmnwedaekfctqqhkgshlvsfhsseevdfvtsktfpi
lkydfvwiglsnvwnectkewsdgtkldykawsggsdcivskttdnqwlsmdcsskyyvv
ckfqa

SCOPe Domain Coordinates for d1c3ab_:

Click to download the PDB-style file with coordinates for d1c3ab_.
(The format of our PDB-style files is described here.)

Timeline for d1c3ab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1c3aa_