Lineage for d1c3ab_ (1c3a B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 37323Fold d.169: C-type lectin-like [56435] (1 superfamily)
  4. 37324Superfamily d.169.1: C-type lectin-like [56436] (5 families) (S)
  5. 37325Family d.169.1.1: C-type lectin domain [56437] (13 proteins)
  6. 37426Protein Snake coagglutinin [56446] (3 species)
  7. 37436Species Habu snake (Trimeresurus flavoviridis), flavocetin-A [TaxId:88087] [56448] (1 PDB entry)
  8. 37438Domain d1c3ab_: 1c3a B: [42344]

Details for d1c3ab_

PDB Entry: 1c3a (more details), 2.5 Å

PDB Description: crystal structure of flavocetin-a from the habu snake venom, a novel cyclic tetramer of c-type lectin-like heterodimers

SCOP Domain Sequences for d1c3ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c3ab_ d.169.1.1 (B:) Snake coagglutinin {Habu snake (Trimeresurus flavoviridis), flavocetin-A}
gfccplgwssydehcyqvfqqkmnwedaekfctqqhkgshlvsfhsseevdfvtsktfpi
lkydfvwiglsnvwnectkewsdgtkldykawsggsdcivskttdnqwlsmdcsskyyvv
ckfqa

SCOP Domain Coordinates for d1c3ab_:

Click to download the PDB-style file with coordinates for d1c3ab_.
(The format of our PDB-style files is described here.)

Timeline for d1c3ab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1c3aa_