Lineage for d1ixxe_ (1ixx E:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 421327Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 421328Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 421329Family d.169.1.1: C-type lectin domain [56437] (22 proteins)
  6. 421539Protein Snake coagglutinin alpha chain [88861] (9 species)
    heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)
  7. 421540Species Habu snake (Trimeresurus flavoviridis) [TaxId:88087] [88862] (4 PDB entries)
  8. 421545Domain d1ixxe_: 1ixx E: [42339]
    Other proteins in same PDB: d1ixxb_, d1ixxd_, d1ixxf_
    complexed with ca

Details for d1ixxe_

PDB Entry: 1ixx (more details), 2.5 Å

PDB Description: crystal structure of coagulation factors ix/x-binding protein (ix/x-bp) from venom of habu snake with a heterodimer of c-type lectin domains

SCOP Domain Sequences for d1ixxe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ixxe_ d.169.1.1 (E:) Snake coagglutinin alpha chain {Habu snake (Trimeresurus flavoviridis)}
dclsgwssyeghcykafekyktwedaervcteqakgahlvsiessgeadfvaqlvtqnmk
rldfyiwiglrvqgkvkqcnsewsdgssvsyenwieaesktclgleketdfrkwvniycg
qqnpfvcea

SCOP Domain Coordinates for d1ixxe_:

Click to download the PDB-style file with coordinates for d1ixxe_.
(The format of our PDB-style files is described here.)

Timeline for d1ixxe_: