| Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
| Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (6 families) ![]() |
| Family d.169.1.1: C-type lectin domain [56437] (21 proteins) |
| Protein Snake coagglutinin alpha chain [88861] (5 species) heterodimeric coagulation factors IX/X-binding protein (IX/X-BP) |
| Species Habu snake (Trimeresurus flavoviridis) [TaxId:88087] [88862] (4 PDB entries) |
| Domain d1ixxe_: 1ixx E: [42339] Other proteins in same PDB: d1ixxb_, d1ixxd_, d1ixxf_ complexed with ca |
PDB Entry: 1ixx (more details), 2.5 Å
SCOP Domain Sequences for d1ixxe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ixxe_ d.169.1.1 (E:) Snake coagglutinin alpha chain {Habu snake (Trimeresurus flavoviridis)}
dclsgwssyeghcykafekyktwedaervcteqakgahlvsiessgeadfvaqlvtqnmk
rldfyiwiglrvqgkvkqcnsewsdgssvsyenwieaesktclgleketdfrkwvniycg
qqnpfvcea
Timeline for d1ixxe_: