Lineage for d1ixxc_ (1ixx C:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 336759Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 336760Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 336761Family d.169.1.1: C-type lectin domain [56437] (21 proteins)
  6. 336965Protein Snake coagglutinin alpha chain [88861] (5 species)
    heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)
  7. 336966Species Habu snake (Trimeresurus flavoviridis) [TaxId:88087] [88862] (4 PDB entries)
  8. 336970Domain d1ixxc_: 1ixx C: [42337]
    Other proteins in same PDB: d1ixxb_, d1ixxd_, d1ixxf_

Details for d1ixxc_

PDB Entry: 1ixx (more details), 2.5 Å

PDB Description: crystal structure of coagulation factors ix/x-binding protein (ix/x-bp) from venom of habu snake with a heterodimer of c-type lectin domains

SCOP Domain Sequences for d1ixxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ixxc_ d.169.1.1 (C:) Snake coagglutinin alpha chain {Habu snake (Trimeresurus flavoviridis)}
dclsgwssyeghcykafekyktwedaervcteqakgahlvsiessgeadfvaqlvtqnmk
rldfyiwiglrvqgkvkqcnsewsdgssvsyenwieaesktclgleketdfrkwvniycg
qqnpfvcea

SCOP Domain Coordinates for d1ixxc_:

Click to download the PDB-style file with coordinates for d1ixxc_.
(The format of our PDB-style files is described here.)

Timeline for d1ixxc_: