SCOP 1.67: Domain d1ixxf_: 1ixx F:

Lineage for d1ixxf_ (1ixx F:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (6 families)

5. Family d.169.1.1: C-type lectin domain [56437] (22 proteins)

6. Protein Snake coagglutinin beta chain [88867] (9 species)
   heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)

7. Species Habu snake (Trimeresurus flavoviridis) [TaxId:88087] [88868] (4 PDB entries)

8. Domain d1ixxf_: 1ixx F: [42340]
   Other proteins in same PDB: d1ixxa_, d1ixxc_, d1ixxe_
   complexed with ca

Details for d1ixxf_

PDB Entry: 1ixx, 2.5 Å

PDB Description: crystal structure of coagulation factors ix/x-binding protein (ix/x-bp) from venom of habu snake with a heterodimer of c-type lectin domains

SCOP Domain Sequences for d1ixxf_:

Sequence; same for both SEQRES and ATOM records:

>d1ixxf_ d.169.1.1 (F:) Snake coagglutinin beta chain {Habu snake (Trimeresurus flavoviridis)}
dcpsdwssyeghcykpfsepknwadaenfctqqhagghlvsfqsseeadfvvklafqtfg
hsifwmglsnvwnqcnwqwsnaamlrykawaeesycvyfkstnnkwrsracrmmaqfvce
fqa

Timeline for d1ixxf_:

• d1ixxf_ first appeared (with stable ids) in SCOP 1.55
  
• d1ixxf_ appears in SCOP 1.65
  
• d1ixxf_ appears in SCOP 1.69
  
• d1ixxf_ appears in the current release, SCOPe 2.08