Lineage for d1qlba3 (1qlb A:251-371)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1226244Fold d.168: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56424] (1 superfamily)
    unusual fold
  4. 1226245Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56425] (1 family) (S)
  5. 1226246Family d.168.1.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56426] (5 proteins)
  6. 1226285Protein Fumarate reductase [56429] (2 species)
  7. 1226297Species Wolinella succinogenes [TaxId:844] [56431] (5 PDB entries)
  8. 1226302Domain d1qlba3: 1qlb A:251-371 [42312]
    Other proteins in same PDB: d1qlba1, d1qlba2, d1qlbb1, d1qlbb2, d1qlbc_, d1qlbd1, d1qlbd2, d1qlbe1, d1qlbe2, d1qlbf_
    complexed with ca, f3s, fad, fes, fum, hem, lmt, sf4

Details for d1qlba3

PDB Entry: 1qlb (more details), 2.33 Å

PDB Description: respiratory complex II-like fumarate reductase from Wolinella succinogenes
PDB Compounds: (A:) Fumarate reductase flavoprotein subunit

SCOPe Domain Sequences for d1qlba3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qlba3 d.168.1.1 (A:251-371) Fumarate reductase {Wolinella succinogenes [TaxId: 844]}
meavqfhptplfpsgilltegcrgdggilrdvdghrfmpdyepekkelasrdvvsrrmie
hirkgkgvqspygqhlwldisilgrkhietnlrdvqeiceyfagidpaekwapvlpmqhy
s

SCOPe Domain Coordinates for d1qlba3:

Click to download the PDB-style file with coordinates for d1qlba3.
(The format of our PDB-style files is described here.)

Timeline for d1qlba3: