SCOPe 2.02: Domain d1qlbe1: 1qlb E:107-239

Lineage for d1qlbe1 (1qlb E:107-239)

Root: SCOPe 2.02
Class a: All alpha proteins [46456] (284 folds)
Fold a.1: Globin-like [46457] (2 superfamilies)
core: 6 helices; folded leaf, partly opened
Superfamily a.1.2: alpha-helical ferredoxin [46548] (2 families)
contains two Fe4-S4 clusters
Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (2 proteins)
Protein Fumarate reductase [46550] (2 species)
Species Wolinella succinogenes [TaxId:844] [46552] (5 PDB entries)

Domain d1qlbe1: 1qlb E:107-239 [15682]
Other proteins in same PDB: d1qlba1, d1qlba2, d1qlba3, d1qlbb2, d1qlbc_, d1qlbd1, d1qlbd2, d1qlbd3, d1qlbe2, d1qlbf_
complexed with ca, f3s, fad, fes, fum, hem, lmt, sf4

Details for d1qlbe1

PDB Entry: 1qlb (more details), 2.33 Å

PDB Description: respiratory complex II-like fumarate reductase from Wolinella succinogenes

PDB Compounds: (E:) fumarate reductase iron-sulfur protein

SCOPe Domain Sequences for d1qlbe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qlbe1 a.1.2.1 (E:107-239) Fumarate reductase {Wolinella succinogenes [TaxId: 844]}
tgnwfngmsqrveswihaqkehdiskleeriepevaqevfeldrciecgcciaacgtkim
redfvgaaglnrvvrfmidphdertdedyyeligdddgvfgcmtllachdvcpknlplqs
kiaylrrkmvsvn

SCOPe Domain Coordinates for d1qlbe1:

Click to download the PDB-style file with coordinates for d1qlbe1.
(The format of our PDB-style files is described here.)

Timeline for d1qlbe1: