Lineage for d8ddza_ (8ddz A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3012720Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3013567Protein automated matches [190161] (29 species)
    not a true protein
  7. 3013652Species Escherichia coli [TaxId:562] [187306] (111 PDB entries)
  8. 3086752Domain d8ddza_: 8ddz A: [423069]
    automated match to d1erma_

Details for d8ddza_

PDB Entry: 8ddz (more details), 1.45 Å

PDB Description: tem-1 beta-lactamase a237y
PDB Compounds: (A:) Beta-lactamase TEM

SCOPe Domain Sequences for d8ddza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d8ddza_ e.3.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
petlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvda
gqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggpk
eltaflhnmgdhvtrldrwepelneaipnderdtttpaamattlrklltgelltlasrqq
lidwmeadkvagpllrsalpagwfiadksgygergsrgiiaalgpdgkpsrivviyttgs
qatmdernrqiaeigaslikhw

SCOPe Domain Coordinates for d8ddza_:

Click to download the PDB-style file with coordinates for d8ddza_.
(The format of our PDB-style files is described here.)

Timeline for d8ddza_:

  • d8ddza_ is new in SCOPe 2.08-stable