Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.167: Peptide deformylase [56419] (1 superfamily) alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix |
Superfamily d.167.1: Peptide deformylase [56420] (2 families) nickel-dependent enzyme |
Family d.167.1.1: Peptide deformylase [56421] (2 proteins) automatically mapped to Pfam PF01327 |
Protein Peptide deformylase [56422] (11 species) |
Species Escherichia coli [TaxId:562] [56423] (21 PDB entries) |
Domain d1defa_: 1def A: [42306] incorrect model(?) complexed with zn |
PDB Entry: 1def (more details)
SCOPe Domain Sequences for d1defa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1defa_ d.167.1.1 (A:) Peptide deformylase {Escherichia coli [TaxId: 562]} svlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivi dvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfel eadgllaiciqhemdhlvgklfmdyls
Timeline for d1defa_: