PDB entry 1def

View 1def on RCSB PDB site
Description: peptide deformylase catalytic core (residues 1-147), nmr, 9 structures
Class: hydrolase
Keywords: hydrolase, zinc metalloprotease
Deposited on 1996-03-19, released 1997-04-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -1.99 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptide deformylase
    Species: Escherichia coli [TaxId:562]
    Gene: FMS (CODONS 1-147)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1defa_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1defA (A:)
    svlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivi
    dvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfel
    eadgllaiciqhemdhlvgklfmdyls