Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore automatically mapped to Pfam PF00502 |
Protein automated matches [190531] (23 species) not a true protein |
Species Proteomonas sulcata [TaxId:77928] [422423] (1 PDB entry) |
Domain d7tlfb_: 7tlf B: [422448] Other proteins in same PDB: d7tlfa_, d7tlfc_, d7tlfe_, d7tlfg_, d7tlfi_, d7tlfk_, d7tlfm_, d7tlfo_ automated match to d1xg0d_ complexed with dbv, peb |
PDB Entry: 7tlf (more details), 2.8 Å
SCOPe Domain Sequences for d7tlfb_:
Sequence, based on SEQRES records: (download)
>d7tlfb_ a.1.1.3 (B:) automated matches {Proteomonas sulcata [TaxId: 77928]} fsrvvtnadskaayvggadlqalkkfisegnkrldavnsivsnascivsdavsgmicenp slispsgncytnrrmaaclrdaeiilryvsyallsgdssvledrclnglketysslgvpa ngnaravsimkacsvafvnntasqkklstpqgdcsglasevagyfdkvtsai
>d7tlfb_ a.1.1.3 (B:) automated matches {Proteomonas sulcata [TaxId: 77928]} fsrvvskaayvggadlqalkkfisegnkrldavnsivsnascivsdavsgmicenpslis psgncytnrrmaaclrdaeiilryvsyallsgdssvledrclnglketysslgvpangna ravsimkacsvafvnntstpqgdcsglasevagyfdkvtsai
Timeline for d7tlfb_: