SCOPe 2.04: Domain d1htl.1: 1htl A:,C:

Lineage for d1htl.1 (1htl A:,C:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)

6. Protein Heat-labile toxin, A-chain [56401] (2 species)

7. Species Escherichia coli, type IB [TaxId:562] [56402] (9 PDB entries)

8. Domain d1htl.1: 1htl A:,C: [42237]
   Other proteins in same PDB: d1htld_, d1htle_, d1htlf_, d1htlg_, d1htlh_
   mutant

Details for d1htl.1

PDB Entry: 1htl, 2.5 Å

PDB Description: mutation of a buried residue causes lack of activity but no conformational change: crystal structure of e. coli heat-labile enterotoxin mutant val 97--> lys

PDB Compounds: (A:) heat-labile enterotoxin, subunit a, (C:) heat-labile enterotoxin, subunit a

SCOPe Domain Sequences for d1htl.1:

Sequence; same for both SEQRES and ATOM records:

>g1htl.1 d.166.1.1 (A:,C:) Heat-labile toxin, A-chain {Escherichia coli, type IB [TaxId: 562]}
rlyradsrppdeikrsgglmprghneyfdrgtqmninlydhargtqtgfvryddgyvsts
lslrsahlagqsilsgystyyiyviatapnmfnkndvlgvysphpyeqevsalggipysq
iygwyrvnfgviderlhrnreyrdryyrnlniapaedgyrlagfppdhqawreepwihha
pqgcgXgdtcneetqnlstiylreyqskvkrqifsdyqsevdiynri

Timeline for d1htl.1:

• d1htl.1 first appeared (with stable ids) in SCOP 1.55
  
• d1htl.1 appears in SCOPe 2.03
  
• d1htl.1 appears in SCOPe 2.05
  
• d1htl.1 appears in the current release, SCOPe 2.08