SCOP 1.55: Domain d1htl.1: 1htl A:,C:

Lineage for d1htl.1 (1htl A:,C:)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)

4. Superfamily d.166.1: ADP-ribosylation [56399] (2 families)

5. Family d.166.1.1: ADP-ribosylating toxins [56400] (7 proteins)

6. Protein Heat-labile toxin, A-chain [56401] (2 species)

7. Species Escherichia coli, type IB [TaxId:562] [56402] (9 PDB entries)

8. Domain d1htl.1: 1htl A:,C: [42237]
   Other proteins in same PDB: d1htld_, d1htle_, d1htlf_, d1htlg_, d1htlh_

Details for d1htl.1

PDB Entry: 1htl, 2.5 Å

PDB Description: mutation of a buried residue causes lack of activity but no conformational change: crystal structure of e. coli heat-labile enterotoxin mutant val 97--> lys

SCOP Domain Sequences for d1htl.1:

Sequence; same for both SEQRES and ATOM records:

>g1htl.1 d.166.1.1 (A:,C:) Heat-labile toxin, A-chain {Escherichia coli, type IB}
rlyradsrppdeikrsgglmprghneyfdrgtqmninlydhargtqtgfvryddgyvsts
lslrsahlagqsilsgystyyiyviatapnmfnkndvlgvysphpyeqevsalggipysq
iygwyrvnfgviderlhrnreyrdryyrnlniapaedgyrlagfppdhqawreepwihha
pqgcgXgdtcneetqnlstiylreyqskvkrqifsdyqsevdiynri

Timeline for d1htl.1:

• d1htl.1 appears in SCOP 1.57
  
• d1htl.1 appears in the current release, SCOPe 2.08