Lineage for d1hwpa_ (1hwp A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1681140Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 1681141Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 1681142Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 1681203Protein Ebulin A-chain [56391] (1 species)
  7. 1681204Species Sambucus ebulus [TaxId:28503] [56392] (4 PDB entries)
  8. 1681207Domain d1hwpa_: 1hwp A: [42225]
    Other proteins in same PDB: d1hwpb1, d1hwpb2
    complexed with pt1

Details for d1hwpa_

PDB Entry: 1hwp (more details), 3.1 Å

PDB Description: ebulin complexed with pteroic acid, trigonal crystal form
PDB Compounds: (A:) ebulin

SCOPe Domain Sequences for d1hwpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hwpa_ d.165.1.1 (A:) Ebulin A-chain {Sambucus ebulus [TaxId: 28503]}
idypsvsfnlagaksttyrdflknlrdrvatgtyevnglpvlrresevqvknrfvlvrlt
nyngdtvtsavdvtnlylvafsangnsyffkdatelqksnlflgttqhtlsftgnydnle
taagtrresielgpnpldgaitslwydggvarsllvliqmvpeaarfryieqevrrslqq
ltsftpnalmlsmennwssmslevqlsgdnvspfsgtvqlqnydhtprlvdnfeelykit
giaillfrcvat

SCOPe Domain Coordinates for d1hwpa_:

Click to download the PDB-style file with coordinates for d1hwpa_.
(The format of our PDB-style files is described here.)

Timeline for d1hwpa_: