Lineage for d1qcia_ (1qci A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 139177Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
  4. 139178Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (2 families) (S)
  5. 139179Family d.165.1.1: Plant cytotoxins [56372] (11 proteins)
  6. 139225Protein Pokeweed antiviral protein alpha [56385] (1 species)
  7. 139226Species Pokeweed (Phytolacca americana) [TaxId:3527] [56386] (7 PDB entries)
  8. 139231Domain d1qcia_: 1qci A: [42201]

Details for d1qcia_

PDB Entry: 1qci (more details), 2 Å

PDB Description: low temperature structure of pokeweed antiviral protein complexed with adenine

SCOP Domain Sequences for d1qcia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qcia_ d.165.1.1 (A:) Pokeweed antiviral protein alpha {Pokeweed (Phytolacca americana)}
vntiiynvgsttiskyatflndlrneakdpslkcygipmlpntntnpkyvlvelqgsnkk
titlmlrrnnlyvmgysdpfetnkcryhifndisgterqdvettlcpnansrvskninfd
sryptleskagvksrsqvqlgiqildsnigkisgvmsftekteaefllvaiqmvseaarf
kyienqvktnfnrafnpnpkvlnlqetwgkistaihdakngvlpkplelvdasgakwivl
rvdeikpdvallnyvggscqtt

SCOP Domain Coordinates for d1qcia_:

Click to download the PDB-style file with coordinates for d1qcia_.
(The format of our PDB-style files is described here.)

Timeline for d1qcia_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qcib_