SCOP 1.57: Domain d1qcia_: 1qci A:

Lineage for d1qcia_ (1qci A:)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)

4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (2 families)

5. Family d.165.1.1: Plant cytotoxins [56372] (11 proteins)

6. Protein Pokeweed antiviral protein alpha [56385] (1 species)

7. Species Pokeweed (Phytolacca americana) [TaxId:3527] [56386] (7 PDB entries)

8. Domain d1qcia_: 1qci A: [42201]

Details for d1qcia_

PDB Entry: 1qci, 2 Å

PDB Description: low temperature structure of pokeweed antiviral protein complexed with adenine

SCOP Domain Sequences for d1qcia_:

Sequence; same for both SEQRES and ATOM records:

>d1qcia_ d.165.1.1 (A:) Pokeweed antiviral protein alpha {Pokeweed (Phytolacca americana)}
vntiiynvgsttiskyatflndlrneakdpslkcygipmlpntntnpkyvlvelqgsnkk
titlmlrrnnlyvmgysdpfetnkcryhifndisgterqdvettlcpnansrvskninfd
sryptleskagvksrsqvqlgiqildsnigkisgvmsftekteaefllvaiqmvseaarf
kyienqvktnfnrafnpnpkvlnlqetwgkistaihdakngvlpkplelvdasgakwivl
rvdeikpdvallnyvggscqtt

Timeline for d1qcia_:

• d1qcia_ first appeared (with stable ids) in SCOP 1.55
  
• d1qcia_ appears in SCOP 1.59
  
• d1qcia_ appears in the current release, SCOPe 2.08