Lineage for d1ahc__ (1ahc -)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily) Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (2 families) 
Family d.165.1.1: Plant cytotoxins [56372] (11 proteins) 
Protein alpha-Momorcharin (momordin) [56377] (1 species) Species Bitter gourd (Momordica charantia) [TaxId:3673] [56378] (8 PDB entries) 
Domain d1ahc__: 1ahc - [42184]
Details for d1ahc__
PDB Entry: 1ahc (more details), 2 Å
PDB Description: the n-glycosidase mechanism of ribosome-inactivating proteins implied by crystal structures of alpha-momorcharin
SCOP Domain Sequences for d1ahc__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ahc__ d.165.1.1 (-) alpha-Momorcharin (momordin) {Bitter gourd (Momordica charantia)}
dvsfrlsgadprsygmfikdlrnalpfrekvyniplllpsvsgagryllmhlfnydgkti
tvavdvtnvyimgyladttsyffnepaaelasqyvfrdarrkitlpysgnyerlqiaagk
prekipiglpaldsaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
pslatislenswsglskqiqlaqgnngifrtpivlvdnkgnrvqitnvtskvvtsniqll
lntrni
SCOP Domain Coordinates for d1ahc__:
Click to download the PDB-style file with coordinates for d1ahc__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ahc__:
- d1ahc__ first appeared (with stable ids) in SCOP 1.55
- d1ahc__ appears in SCOP 1.59
- d1ahc__ appears in SCOP 1.63
- d1ahc__ appears in the current release, SCOPe 2.08, called d1ahca_
View in 3D