Lineage for d1ahc__ (1ahc -)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 139177Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
  4. 139178Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (2 families) (S)
  5. 139179Family d.165.1.1: Plant cytotoxins [56372] (11 proteins)
  6. 139183Protein alpha-Momorcharin (momordin) [56377] (1 species)
  7. 139184Species Bitter gourd (Momordica charantia) [TaxId:3673] [56378] (8 PDB entries)
  8. 139186Domain d1ahc__: 1ahc - [42184]

Details for d1ahc__

PDB Entry: 1ahc (more details), 2 Å

PDB Description: the n-glycosidase mechanism of ribosome-inactivating proteins implied by crystal structures of alpha-momorcharin

SCOP Domain Sequences for d1ahc__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ahc__ d.165.1.1 (-) alpha-Momorcharin (momordin) {Bitter gourd (Momordica charantia)}
dvsfrlsgadprsygmfikdlrnalpfrekvyniplllpsvsgagryllmhlfnydgkti
tvavdvtnvyimgyladttsyffnepaaelasqyvfrdarrkitlpysgnyerlqiaagk
prekipiglpaldsaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
pslatislenswsglskqiqlaqgnngifrtpivlvdnkgnrvqitnvtskvvtsniqll
lntrni

SCOP Domain Coordinates for d1ahc__:

Click to download the PDB-style file with coordinates for d1ahc__.
(The format of our PDB-style files is described here.)

Timeline for d1ahc__: