Lineage for d7e98c_ (7e98 C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2689395Family a.1.1.0: automated matches [191420] (1 protein)
    not a true family
  6. 2689396Protein automated matches [190590] (26 species)
    not a true protein
  7. 2689508Species Oligobrachia mashikoi [TaxId:55676] [187601] (8 PDB entries)
  8. 3085247Domain d7e98c_: 7e98 C: [421564]
    automated match to d2zs0c_
    complexed with gol, hem, oxy

Details for d7e98c_

PDB Entry: 7e98 (more details), 2.2 Å

PDB Description: oxy-deoxy intermediate of 400 kda giant hemoglobin at 21% oxygen saturation
PDB Compounds: (C:) Extracellular giant hemoglobin major globin subunit B2

SCOPe Domain Sequences for d7e98c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7e98c_ a.1.1.0 (C:) automated matches {Oligobrachia mashikoi [TaxId: 55676]}
sccssedranvmhnwdaawsaaysdrrvalaqavfaslfsrdaaaqglfsgvsadnpdsa
dfrahcvrvvngldvainmlndpavlneqlahlsaqhqaragvaaahfdvmaeafaevmp
qvsscfssdswnrcfariangisagl

SCOPe Domain Coordinates for d7e98c_:

Click to download the PDB-style file with coordinates for d7e98c_.
(The format of our PDB-style files is described here.)

Timeline for d7e98c_:

  • d7e98c_ is new in SCOPe 2.08-stable