Lineage for d1a5za2 (1a5z A:164-333)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1680346Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1680347Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1680348Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 1680355Protein Lactate dehydrogenase [56339] (19 species)
  7. 1680513Species Thermotoga maritima [TaxId:2336] [56347] (1 PDB entry)
  8. 1680514Domain d1a5za2: 1a5z A:164-333 [42148]
    Other proteins in same PDB: d1a5za1
    complexed with cd, fbp, nad, oxm

Details for d1a5za2

PDB Entry: 1a5z (more details), 2.1 Å

PDB Description: lactate dehydrogenase from thermotoga maritima (tmldh)
PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d1a5za2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a5za2 d.162.1.1 (A:164-333) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]}
gtvldtarlrtliaqhcgfsprsvhvyvigehgdsevpvwsgamiggiplqnmcqvcqkc
dskilenfaektkraayeiierkgathyaialavadivesiffdekrvltlsvyledylg
vkdlcisvpvtlgkhgverilelnlneeeleafrksasilknaineitaeen

SCOPe Domain Coordinates for d1a5za2:

Click to download the PDB-style file with coordinates for d1a5za2.
(The format of our PDB-style files is described here.)

Timeline for d1a5za2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a5za1