Lineage for d1llca2 (1llc A:165-334)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1440931Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1440932Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1440933Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 1440940Protein Lactate dehydrogenase [56339] (18 species)
  7. 1441007Species Lactobacillus casei [TaxId:1582] [56345] (6 PDB entries)
  8. 1441036Domain d1llca2: 1llc A:165-334 [42143]
    Other proteins in same PDB: d1llca1
    complexed with afp, so4

Details for d1llca2

PDB Entry: 1llc (more details), 3 Å

PDB Description: structure determination of the allosteric l-lactate dehydrogenase from lactobacillus casei at 3.0 angstroms resolution
PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d1llca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1llca2 d.162.1.1 (A:165-334) Lactate dehydrogenase {Lactobacillus casei [TaxId: 1582]}
tsldtarfrqsiaemvnvdarsvhayimgehgdtefpvwshaniggvtiaewvkahpeik
edklvkmfedvrdaayeiiklkgatfygiatalariskailndenavlplsvymdgqygi
ndlyigtpavinrngiqnileipltdheeesmqksasqlkkvltdafakndi

SCOPe Domain Coordinates for d1llca2:

Click to download the PDB-style file with coordinates for d1llca2.
(The format of our PDB-style files is described here.)

Timeline for d1llca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1llca1