| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) ![]() |
| Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) automatically mapped to Pfam PF02866 |
| Protein Lactate dehydrogenase [56339] (18 species) |
| Species Lactobacillus casei [TaxId:1582] [56345] (6 PDB entries) |
| Domain d1llca2: 1llc A:165-334 [42143] Other proteins in same PDB: d1llca1 complexed with afp, so4 |
PDB Entry: 1llc (more details), 3 Å
SCOPe Domain Sequences for d1llca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1llca2 d.162.1.1 (A:165-334) Lactate dehydrogenase {Lactobacillus casei [TaxId: 1582]}
tsldtarfrqsiaemvnvdarsvhayimgehgdtefpvwshaniggvtiaewvkahpeik
edklvkmfedvrdaayeiiklkgatfygiatalariskailndenavlplsvymdgqygi
ndlyigtpavinrngiqnileipltdheeesmqksasqlkkvltdafakndi
Timeline for d1llca2: