Lineage for d1llc_2 (1llc 165-334)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.162: Lactate & malate dehydrogenases, C-terminal domain [56326] (1 superfamily) Superfamily d.162.1: Lactate & malate dehydrogenases, C-terminal domain [56327] (1 family) 
Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (3 proteins) Protein Lactate dehydrogenase [56339] (8 species) 
Species Lactobacillus casei [TaxId:1582] [56345] (1 PDB entry) 
Domain d1llc_2: 1llc 165-334 [42143]
Other proteins in same PDB: d1llc_1
Details for d1llc_2
PDB Entry: 1llc (more details), 3 Å
PDB Description: structure determination of the allosteric l-lactate dehydrogenase from lactobacillus casei at 3.0 angstroms resolution
SCOP Domain Sequences for d1llc_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1llc_2 d.162.1.1 (165-334) Lactate dehydrogenase {Lactobacillus casei}
tsldtarfrqsiaemvnvdarsvhayimgehgdtefpvwshaniggvtiaewvkahpeik
edklvkmfedvrdaayeiiklkgatfygiatalariskailndenavlplsvymdgqygi
ndlyigtpavinrngiqnileipltdheeesmqksasqlkkvltdafakndi
SCOP Domain Coordinates for d1llc_2:
Click to download the PDB-style file with coordinates for d1llc_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1llc_2:
- d1llc_2 appears in SCOP 1.57
- d1llc_2 appears in the current release, SCOPe 2.08, called d1llca2
View in 3D
